USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
South Africa
Arabic ArabicBulgarian BulgarianCroatian CroatianCzech CzechDanish DanishDutch DutchFinnish FinnishFrench FrenchGerman GermanGreek GreekHebrew HebrewHungarian HungarianItalian ItalianJapanese JapaneseHebrew HebrewJapanese JapaneseNorwegian NorwegianPolish PolishPortuguese PortuguesePortuguese BR Portuguese BRNorwegian NorwegianPolish PolishPortuguese BR Portuguese BRPortuguese PortugueseRomanian RomanianRussian RussianSlovenian SlovenianSpanish SpanishSwedish SwedishThai ThaiTurkish TurkishUkrainian UkrainianVietnamese Vietnamese
0 items
New Products
We trade on BidorBuy as Popular Culture. Click on our badge below.

I am a verified seller on bidorbuy.co.za

You will need a credit card or a debit card to transact on our website.
Product Details
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Legends 1986-1987 Set - Issues 1-6 (NM-)(9.4)
Brand:DC Comics
Product Code:November, 1986 - April, 1987
weight:70.0g
Product Condition:Used
$520.00 inc. tax
Add to Cart
Description
All 6 issues of this landmark mini-series is offered as a set.
All issues are Direct Edition.

Detailed biographical information of each issue in this series is available at https://www.comics.org/series/3156/ .

Publication Dates:
November 1986 - April 1987
Number of Issues Published:
6 (#1 - #6)
Color:
Color
Dimensions:
Standard Modern Age U.S.
Paper Stock:
Glossy cover; Newsprint interior
Binding:
Saddle-stitched
Publishing Format:
Miniseries
Publication Type:
magazine

Notes
Darkseid plots to destroy the concept of super-hero legends. Crosses-over with many DC titles. (Cross-overs give sequence numbers on covers). New Justice League (DC, 1987 series), Suicide Squad (DC, 1987 series), and Flash (DC, 1987 series) comics spun off. Shazam! The New Beginning (DC, 1987 series) miniseries takes place shortly before the events in Legends #1. Wonder Woman's appearance coincides with events concurrently happening in her new series (DC, 1987 series) at the time.

New Justice League (DC, 1987 series), Suicide Squad (DC, 1987 series), and Flash (DC, 1987 series) comics spun off.

Notable Issues

Issue 1: First Appearance of Amanda Waller and the new Captain Marvel.

Issue 3: First appearance of the new Suicide Squad. Spins off into Suicide Squad (1987) series.
Death of Blockbuster.

Issue 6: First appearance of new Justice League. Spins off into Justice League (1987) series.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------